PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_021729-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 313aa    MW: 34952 Da    PI: 5.6061
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_021729-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-183277148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T+eE++ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  AHYPO_021729-RA 32 RGKFTPEEEQTILNLHAILGNK-WSAIANHLP-GRTDNEIKNFWNTHL 77
                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-5527IPR009057Homeodomain-like
PROSITE profilePS500904.414926IPR017877Myb-like domain
SuperFamilySSF466891.58E-162687IPR009057Homeodomain-like
PROSITE profilePS5129427.7762781IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-262882IPR009057Homeodomain-like
SMARTSM007171.2E-173179IPR001005SANT/Myb domain
PfamPF002491.7E-173277IPR001005SANT/Myb domain
CDDcd001677.83E-143477No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRSPCCDET GLKKGPWTPE EDEKLVKPDI KRGKFTPEEE QTILNLHAIL GNKWSAIANH  60
LPGRTDNEIK NFWNTHLKKK LIQMGFDPMT HRPRTDIFSS LPHLIALANI KDLIENNSWD  120
EQAVRLQTEV AKLQFLQHLF QPPNNYSMPN LDMESLNILN SLPSPFSTEH NNHNHNHNNN  180
HNNPITNIPG LDNPNVFEDI HEHLPDLKTL EIPPNLISKD NNINTSISVV NHDQVVYNHQ  240
PCEYTILSLG ENSPTSPWIS SSTPSPPPVN ASGSAATSAP PIDGCINTSA TASSFSWPDH  300
LILEDSLFHD IP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1412815108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680536.11e-130PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP01e-45MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0J8C9391e-130A0A0J8C939_BETVU; Uncharacterized protein
STRINGVIT_07s0141g00100.t013e-86(Vitis vinifera)
STRINGPOPTR_0005s07590.15e-86(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.18e-68myb domain protein 92